SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q86XE0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q86XE0
Domain Number 1 Region: 25-164
Classification Level Classification E-value
Superfamily PX domain 0.00000000000818
Family PX domain 0.011
Further Details:      
 
Weak hits

Sequence:  Q86XE0
Domain Number - Region: 291-395
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.015
Family BAR domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q86XE0
Sequence length 403
Comment (sp|Q86XE0|SNX32_HUMAN) Sorting nexin-6B KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=SNX32; OC=Catarrhini; Hominidae; Homo.
Sequence
METYAEVGKEGKPSCASVDLQGDSSLQVEISDAVSERDKVKFTVQTKSCLPHFAQTEFSV
VRQHEEFIWLHDAYVENEEYAGLIIPPAPPRPDFEASREKLQKLGEGDSSVTREEFAKMK
QELEAEYLAIFKKTVAMHEVFLQRLAAHPTLRRDHNFFVFLEYGQDLSVRGKNRKELLGG
FLRNIVKSADEALITGMSGLKEVDDFFEHERTFLLEYHTRIRDACLRADRVMRAHKCLAD
DYIPISAALSSLGTQEVNQLRTSFLKLAELFERLRKLEGRVASDEDLKLSDMLRYYMRDS
QAAKDLLYRRLRALADYENANKALDKARTRNREVRPAESHQQLCCQRFERLSDSAKQELM
DFKSRRVSSFRKNLIELAELELKHAKASTLILRNTLVALKGEP
Download sequence
Identical sequences Q86XE0
gi|72534838|ref|NP_689973.2| ENSP00000310620 9606.ENSP00000310620 ENSP00000310620 ENSP00000310620 NP_689973.2.87134 NP_689973.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]