SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q86XR5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q86XR5
Domain Number - Region: 61-93
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0575
Family Formin homology 2 domain (FH2 domain) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q86XR5
Sequence length 153
Comment (sp|Q86XR5|PRIMA_HUMAN) Proline-rich membrane anchor 1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=PRIMA1; OC=Catarrhini; Hominidae; Homo.
Sequence
MLLRDLVLRRGCCWSSLLLHCALHPLWGFVQVTHGEPQKSCSKVTDSCRHVCQCRPPPPL
PPPPPPPPPPRLLSAPAPNSTSCPTEESWWSGLVIIIAVCCASLVFLTVLVIICYKAIKR
KPLRKDENGTSVAEYPMSASQSNKGVDVNNAVV
Download sequence
Identical sequences A0A024R6J9 A0A2I3S609 A0A2J8TLX8 G3REW9 Q86XR5
ENSGGOP00000014118 9606.ENSP00000376848 ENSGGOP00000014118 gi|29788778|ref|NP_821092.1| ENSP00000320948 ENSP00000376848 ENSP00000376851 NP_821092.1.87134 NP_821092.1.92137 XP_003832847.1.60992 XP_004055656.1.27298 XP_008956479.1.60992 XP_008956481.1.60992 XP_011534758.1.92137 XP_016782143.1.37143 XP_016782144.1.37143 XP_018895532.1.27298 ENSP00000376848 ENSP00000376851 ENSP00000479082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]