SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q86XZ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q86XZ4
Domain Number 1 Region: 30-94
Classification Level Classification E-value
Superfamily UBA-like 0.00000134
Family UBA domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q86XZ4
Sequence length 545
Comment (sp|Q86XZ4|SPAS2_HUMAN) p59scr KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=SPATS2; OC=Catarrhini; Hominidae; Homo.
Sequence
MSRKQNQKDSSGFIFDLQSNTVLAQGGAFENMKEKINAVRAIVPNKSNNEIILVLQHFDN
CVDKTVQAFMEGSASEVLKEWTVTGKKKNKKKKNKPKPAAEPSNGIPDSSKSVSIQEEQS
APSSEKGGMNGYHVNGAINDTESVDSLSEGLETLSIDARELEDPESAMLDTLDRTGSMLQ
NGVSDFETKSLTMHSIHNSQQPRNAAKSLSRPTTETQFSNMGMEDVPLATSKKLSSNIEK
SVKDLQRCTVSLARYRVVVKEEMDASIKKMKQAFAELESCLMDREVALLAEMDKVKAEAM
EILLSRQKKAELLKKMTHVAVQMSEQQLVELRADIKHFVSERKYDEDLGRVARFTCDVET
LKKSIDSFGQVSHPKNSYSTRSRCSSVTSVSLSSPSDASAASSSTCASPPSLTSANKKNF
APGETPAAIANSSGQPYQPLREVLPGNRRGGQGYRPQGQKSNDPMNQGRHDSMGRYRNSS
WYSSGSRYQSAPSQAPGNTIERGQTHSAGTNGTGVSMEPSPPTPSFKKGLPQRKPRTSQT
EAVNS
Download sequence
Identical sequences A0A024R101 Q86XZ4
GO.34914 gi|148746220|ref|NP_075559.2| NP_001280214.1.87134 NP_001280214.1.92137 NP_001280215.1.87134 NP_001280215.1.92137 NP_075559.2.87134 NP_075559.2.92137 XP_011536992.1.92137 XP_011536993.1.92137 ENSP00000326841 ENSP00000326841 ENSP00000447947 ENSP00000448228 9606.ENSP00000326841 ENSP00000326841 ENSP00000447947 ENSP00000448228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]