SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q874E9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q874E9
Domain Number 1 Region: 37-227
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.23e-23
Family Cutinase-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q874E9
Sequence length 239
Comment (tr|Q874E9|Q874E9_9TREE) Cutinase-like protein {ECO:0000313|EMBL:BAC67242.1} OX=87049 OS=Cryptococcus sp. S-2. GN=CLE1 OC=Tremellomycetes; Tremellales; Cryptococcaceae; Cryptococcus.
Sequence
MLVSALALAVLSAASLGRAAPTPESAEAHELEARATSSACPQYVLINTRGTGEPQGQSAG
FRTMNSQITAALSGGTIYNTVYTADFSQNSAAGTADIIRRINSGLAANPNVCYILQGYSQ
GAAATVVALQQLGTSGAAFNAVKGVFLIGNPDHKSGLTCNVDSNGGTTTRNVNGLSVAYQ
GSVPSGWVSKTLDVCAYGDGVCDTAHGFGINAQHLSYPSDQGVQTMGYKFAVNKLGGSA
Download sequence
Identical sequences Q874E9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]