SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8A103 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8A103
Domain Number 1 Region: 159-481
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.35e-75
Family beta-N-acetylhexosaminidase catalytic domain 0.00022
Further Details:      
 
Domain Number 2 Region: 30-158
Classification Level Classification E-value
Superfamily beta-N-acetylhexosaminidase-like domain 7.07e-23
Family Hyaluronidase N-terminal domain-like 0.037
Further Details:      
 
Weak hits

Sequence:  Q8A103
Domain Number - Region: 531-660
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00435
Family Clostridium neurotoxins, the second last domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8A103
Sequence length 661
Comment (tr|Q8A103|Q8A103_BACTN) Beta-N-hexosaminidase, glycosyl hyrolase family 20 {ECO:0000313|EMBL:AAO78973.1} KW=Complete proteome; Reference proteome OX=226186 OS=NCTC 10582 / E50 / VPI-5482). GN=BT_3868 OC=Bacteroides.
Sequence
MRNKFVSLQALALLVIFCLTGSLTRAAVNPKPFVVPELKQWTGKDGNFTPGKDTRIVCTS
QNPELLRIARMFADDYQQMFGQTLSVAQGKATSGDFVLSLSADKKLGEEGYAIKITDRVA
ISAPTPTGLYWSTRTLLQLAEQNQERSLPQGTIRDYPDYPLRGFMIDCGRKFIPMAYLQD
LVKIMAYYKMNTLQVHLNDNGFKQYFEHNWDKTYAAFRLESETYPGLTARDGSYSKKEFI
DFQKQAASNFVEIIPEIDVPAHSLALTHYKPEIGSKEYGMDHLDLFKPETYEFVDALFKE
YLEGDNPVFVGKRVHIGTDEYSNAKKDVVEKFRAFTDHYIRFVEGFGKQAVVWGALSHAK
GDTPVKSENVVMNAWYNGYADPATMIKDGYQLISIPDGLVYIVPKAGYYYDYLNEPYLYK
EWTPAHIGKAVFDEKHPSILGGMFAIWNDHVGNGISVKDIHHRIFSPLQTLSVKMWTGAQ
TGIPYETFNEKRALLSEAPGVNQLARIGKKPELVYERSTVAPGSTSDYPEIGYNYTVSFD
ITGAKESEGTELFRSPNAVFYLSDPIRGMMGFARDGYLNTFPYKVNPGEKATIQIEGNNR
STTLRVNGKVVDEMNTQKLYFNAGKDSMNYVRTLVFPLEKAGNFNSKVQNLKVYNYCVSK
P
Download sequence
Identical sequences Q8A103
NYSGXRC-11093b gi|29349276|ref|NP_812779.1| 226186.BT_3868 NP_812779.1.73244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]