SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8A1H8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8A1H8
Domain Number 1 Region: 20-283
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.59e-63
Family Glycosyl hydrolases family 16 0.0022
Further Details:      
 
Domain Number 2 Region: 300-418,466-629
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 3.28e-59
Family Glycosyl hydrolases family 32 N-terminal domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8A1H8
Sequence length 631
Comment (tr|Q8A1H8|Q8A1H8_BACTN) Beta-glucanase {ECO:0000313|EMBL:AAO78788.1} KW=Complete proteome; Reference proteome OX=226186 OS=NCTC 10582 / E50 / VPI-5482). GN=BT_3683 OC=Bacteroides.
Sequence
MKIKKIVNLMMGLSFSLCIFAQDDWQLVWSDEFNADGPLNSSVWNFEQGYARNEEAQWYQ
SDNAVCKNGLLIIEARKEQNRKNPLYVSGSNDWRKKREFIDYTSSSVTTAGKKEFLYGRF
EIKARIPVAKGAWPAIWTLGSNMEWPSCGEIDIMEYYQIKGTPHILANAAWGTDRQWHAK
WDSQATPYSHFTDKDPDWASKFHIWRMDWDEEAIKLYLDDELLNEIPLSSTRNGSIGKGT
NPFTKPQYLLLNLAIGGINGGPIDEAALPMKYEIDYVRVYQKEKGIASGKVWRDTDGNVI
NAHGGGILFHEGKYYWFGEHRPASGFVTEKGINCYSSTDLYNWKSEGIALAVSEEEGHDI
EKGCIMERPKVIYNAKTGKFVMWLHLELKGQGYGPARAAVAVSDSPAGPYRFIRSGRVNP
GAYPLNMTRKERKMKWNPEEYKEWWTPKWYEAIAKGMFVKRDLKDGQMSRDMTLFVDDDG
KAYHIYSSEDNLTLQIAELADDYLSHTGKYIRIFPGGHNEAPAIFKKEGTYWMITSGCTG
WDPNKARLLTADSMLGEWKQLPNPCVGEDADKTFGGQSTYILPLPEKGQFFFMADMWRPK
SLADSRYIWLPVQFDDKGVPFIKWMDRWNFD
Download sequence
Identical sequences A0A0P0F4Y6 C6IPU9 Q8A1H8
NP_812594.1.73244 WP_008767018.1.24025 WP_008767018.1.28290 WP_008767018.1.59346 WP_008767018.1.83447 WP_008767018.1.97929 gi|29349091|ref|NP_812594.1| 226186.BT_3683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]