SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8A2X9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8A2X9
Domain Number 1 Region: 310-605
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.85e-17
Family Glycosyl hydrolases family 16 0.028
Further Details:      
 
Weak hits

Sequence:  Q8A2X9
Domain Number - Region: 157-240
Classification Level Classification E-value
Superfamily CalX-like 0.0497
Family CalX-beta domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8A2X9
Sequence length 623
Comment (tr|Q8A2X9|Q8A2X9_BACTN) Aldehyde dehydrogenase {ECO:0000313|EMBL:AAO78282.1} KW=Complete proteome; Reference proteome OX=226186 OS=NCTC 10582 / E50 / VPI-5482). GN=BT_3176 OC=Bacteroides.
Sequence
MIKRILYTFLPVCLLATGFAGCDDDAVEPLPETVPLIIEASGKSFVMGEELTLTVKVNDE
KNPQLTTNEDFDVYLTAKDGEMDVSKIAFKDFPSMVTVPKGVSSFDIKLPIVESGLEPKQ
KLTVNVTAFVRGYAMTNPTQTVVVSDHYYTVVSLKNNSDNIINEGDEFTIQVQTPVPVKD
DMDINITIPDDQKSLYETLPPVTLTVNAGETLAEAKVKTKHNLSPTQHETLVLNFTTISV
MYPLDNDKMEIIMKDLEAGKGSKLLDERWVYDHPGIPFASSGRQTAVVEQYGDAVLMKEL
DAHPNADLAAAGWKFYNAWEFHSVGNSGDMWNNGNSFGNKVPLFLAARNTVIVQNHAACI
NEQFSKITDDGYLRMIEMKVPSNATAPASGQRDYGTAAFYGCGTGSPWKSNSQLISEGCR
MEIRARLRGQKNGFNMGIWLVSDESAGQKSYSEIDILENPVGPVTGDRAHQTFHTGPTTT
DNKTKTANNTINMTEWNIYWVEWRSDTEVAIGINGEETVTLKKSECTEEEWTFTNAKNEK
GLKFILTMGAPNKWGLGGGTETGGVWSPDAGWDSGFASYNNYERDKENDAIPRLEIDWVR
TYINKATVADYELGKAKNGTKFY
Download sequence
Identical sequences A0A139KR07 Q8A2X9
NP_812088.1.73244 WP_011108691.1.29471 WP_011108691.1.59346 WP_011108691.1.81417 226186.BT_3176 gi|29348585|ref|NP_812088.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]