SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8A373 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8A373
Domain Number 1 Region: 112-409
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 2.29e-90
Family Glycosyl hydrolases family 32 N-terminal domain 0.000000749
Further Details:      
 
Domain Number 2 Region: 408-548
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-16
Family Glycosyl hydrolases family 32 C-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8A373
Sequence length 548
Comment (tr|Q8A373|Q8A373_BACTN) 2,6-beta-D-fructofuranosidase {ECO:0000313|EMBL:AAO78188.1} KW=Complete proteome; Reference proteome OX=226186 OS=NCTC 10582 / E50 / VPI-5482). GN=BT_3082 OC=Bacteroides.
Sequence
MKTLSRTVLTLFVLSFSCLAAIAGEVSFKITKQYLNFPISHKENRGRMTFEVNGKPDLSV
VIRLAPDEAEYWVFKDVSAFKGKTIKITYDGNEKGLSKIYQSDEIEGQAELYKEKNRPQF
HFTTRRGWINDPNGLIYYEGEYHLFYQHNPFERDWENMHWGHAVSKDLIHWTELPDALYP
DHLGTMFSGSAVIDYDNTAGFNKGKTPAMVAAFTAASSDRQVQGIAYSLDKGRTFTKYDK
NPVINSKEKWNSQDTRDPKVFWYAPSKHWVLVLNERDGHSIYTSSNLKDWKYESHVTGFW
ECPELFELPVDGDKNHTKWVMYGATGTYMLGSFDGKVFTPEAGKYCYTTGSIYAAQTFTN
IPASDGRRIQIGWGRISHPGMPFNGMMMLPTELTLRTTKDGIRLVNVPVKEVESLCKPLR
SWKSLSSDEANRHLKEFYDADCLRIKTTIKLSHATDAGFNLFGQRMIGYDMNSNTLNGRF
YSPQDPTSMELSADIYIDRTSIEVFIDGGLYSYSMERRPDTNNREGLHFWGNRIEVKDLQ
VFSVESIW
Download sequence
Identical sequences A0A174L8C2 Q8A373
gi|29348491|ref|NP_811994.1| NP_811994.1.73244 WP_011108622.1.52087 226186.BT_3082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]