SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8A4P7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8A4P7
Domain Number 1 Region: 27-265
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.34e-56
Family Glycosyl hydrolases family 16 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8A4P7
Sequence length 268
Comment (tr|Q8A4P7|Q8A4P7_BACTN) Beta-glucanase {ECO:0000313|EMBL:AAO77657.1} KW=Complete proteome; Reference proteome OX=226186 OS=NCTC 10582 / E50 / VPI-5482). GN=BT_2550 OC=Bacteroides.
Sequence
MKQFRNLLFISTLLLCWVLVSCKTTRVSSSGWSLVWEENFNQKKGFDPQVWSKIPRGKAD
WNNYMTDFDSCFAMRKGKLVLRGIANQTLPNDTAPYLTGGVYTKGKKAFLDGRIEICAKL
NAAKGAWPAIWLLPENAKWPSGGEIDVMERLNDDSIAYQTVHSHYTYTLGIKEHPKSHFT
GVIHPDRYNVFAVEMYPDSLSFYVNDIHTFTYPRIQTQKEGQFPFDQPFYLLIDMQLGGS
WVGVVDPKDLPVEMEVDWVRFYQRKSLK
Download sequence
Identical sequences A0A1H6CLF8 Q8A4P7 R7KGD5
gi|29347960|ref|NP_811463.1| 226186.BT_2550 NP_811463.1.73244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]