SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8A5N5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8A5N5
Domain Number 1 Region: 52-258
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.28e-27
Family Clostridium neurotoxins, the second last domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8A5N5
Sequence length 317
Comment (tr|Q8A5N5|Q8A5N5_BACTN) Concanavalin A-like lectin/glucanase {ECO:0000313|EMBL:AAO77310.1} KW=Complete proteome; Reference proteome OX=226186 OS=NCTC 10582 / E50 / VPI-5482). GN=BT_2203 OC=Bacteroides.
Sequence
MYTHLTDMTNMLDTAKIGTSDGTFPLANAQNLQKAVEELQTGISKGMAGYFVLQYEIDNY
CIAAEKAIAEFQDSYQQTLQPGTPAELKVFGIDGKGRIEFGSDPAYGGGNTFTVESWVKY
DAGFFESGIGSFLSTFDGKQPNEGWMINFLGSNLRTTIGMGPQEGRVLEEGRAYPDNFGK
WNHVVTVWDNTLPEGQLKMYVNGELFFSKTNDVKNDAGVLQNYMPNTRNQNMWAFQEPTD
NSRCMTGFIKKFRMWSTAKSANEVKTLMNSDVTGTESGLVCAWDFTTVVEDVTNIPDKTG
KHVAKIVGNYKWFKVEN
Download sequence
Identical sequences A0A139KVY9 Q8A5N5
NP_811116.1.73244 WP_011108169.1.29471 WP_011108169.1.59346 WP_011108169.1.81417 WP_011108169.1.83447 gi|29347613|ref|NP_811116.1| 226186.BT_2203 APC81706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]