SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8A6W6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8A6W6
Domain Number 1 Region: 44-354
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 7.85e-50
Family Glycosyl hydrolases family 32 N-terminal domain 0.0068
Further Details:      
 
Domain Number 2 Region: 407-519
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000938
Family Glycosyl hydrolases family 32 C-terminal domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8A6W6
Sequence length 523
Comment (tr|Q8A6W6|Q8A6W6_BACTN) Glycoside hydrolase family 32 {ECO:0000313|EMBL:AAO76867.1} KW=Complete proteome; Reference proteome OX=226186 OS=NCTC 10582 / E50 / VPI-5482). GN=BT_1760 OC=Bacteroides.
Sequence
MMKNMILPIAFTALIASMTACSDETDPILTQKNWDGTATYFQSSDEHGFSMYYKPQVGFV
GDPMPFYDPVAKDFKVMYLQDYRPNPEATYHPIFGVATKDGATYESLGELISCGGRDEQD
AAIGTGGTIYNPADKLYYTFYTGNKFKPSSDQNAQVVMVATSPDFKTWTKNRTFYLKGDT
YGYDKNDFRDPFLFQTEDGVYHMLIATRKNGKGHIAEFTSADLKEWESAGTFMTMMWDRF
YECPDVFKMGDWWYLIYSEQASFMRKVQYFKGRTLEDLKATTANDAGIWPDNREGMLDSR
AFYAGKTASDGTNRYIWGWCPTRAGNDNGNVGDVEPEWAGNLVAQRLIQHEDGTLTLGVP
DAIDRKYTSAQEVKVMAKDGNMIESGKTYTLGEGASVIFNRLKVHNKISFTVKTASNTDR
FGISFVRGTDSASWYSIHVNADEGKANFEKDGDDAKYLFDNKFNIPADNEYRVTIYSDQS
VCVTYINDQLSFTNRIYQMQKNPWSLCCYKGEITVSDVQVSTY
Download sequence
Identical sequences A0A0P0F2Q3 C6IRF5 Q8A6W6
gi|29347170|ref|NP_810673.1| NP_810673.1.73244 WP_008767781.1.24025 WP_008767781.1.28290 WP_008767781.1.97929 BtR275 226186.BT_1760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]