SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8A891 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8A891
Domain Number 1 Region: 197-397
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.54e-22
Family Clostridium neurotoxins, the second last domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8A891
Sequence length 440
Comment (tr|Q8A891|Q8A891_BACTN) Putative patatin-like protein {ECO:0000313|EMBL:AAO76390.1} KW=Complete proteome; Reference proteome OX=226186 OS=NCTC 10582 / E50 / VPI-5482). GN=BT_1283 OC=Bacteroides.
Sequence
MKKQKIRFAIFMLLLAVTACDNADYSKSAPFDNGVYLSVAESKTSETMTFNKTIIQREKS
FTARLAYPAGTDVTVNVTVDPSQVEAYNSRNNTSYDILPAKHYRLESNEMTIRAGKINSA
PLHIYFENLTELEIDKAYLCPVSLNSAQGVGLLDGSTTYWYIVKRSSAITTAVDLRYCYV
EVPGFYVPKWGTEPAGNAAHLNNLKAVTFEIITRISNFDEANTDISSLMGIEQYFCFRAG
DAGFPRQQLQIQTPAGKFPEANKAKLLKENEWYHLALTYDIATKTIIFYVNGKEQSRSTN
YGNSEFSEIKLANRKQESFPGASDGDWLFYIGRSYNDRWLIDRQLNGNVCEARIWDVART
QQEIWKNMYDIEDPENEAHLAAYWKFNEGSSNDIKDYSKYHNDAHIVRYWKDFNSKEEYD
VKNEELWPSGIEVPQVNRED
Download sequence
Identical sequences A0A2J6A9R1 Q8A891
NP_810196.1.73244 WP_011107688.1.24025 gi|29346693|ref|NP_810196.1| 226186.BT_1283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]