SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8A8Y0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8A8Y0
Domain Number 1 Region: 176-358
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.53e-16
Family Clostridium neurotoxins, the second last domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8A8Y0
Sequence length 395
Comment (tr|Q8A8Y0|Q8A8Y0_BACTN) Concanavalin A-like lectin/glucanase {ECO:0000313|EMBL:AAO76144.1} KW=Complete proteome; Reference proteome OX=226186 OS=NCTC 10582 / E50 / VPI-5482). GN=BT_1037 OC=Bacteroides.
Sequence
MAFGVLALVHTACENAKYDVIDNLVYINEASTSKTKELTLTEGTTRTSLTVRLVNIINQT
IKANLFIDESVLDAYNKKNETNYKMPPKEYISFPESVTIEAGSVSADPVNVDIKSFEAEG
GAQYAIPISIKNVEGGIEKSESSSSFLLVLVKPLKQAVPKLTWYNGMHAAPEGAWGLALP
NYTLEWWSKVTSKSGNGGYTKNNQAIINSGGLGTELYIRFGDLIYSENGSYKNNFLQVKT
MGSQFDTGDPTKGKGLEAQKWYHFAVSYDAASGTTLLYQNGTVVASLSSSIGQPMNIDQF
QMISSGEEYFPDFCEMCQVRFWKVTRTVNQIKKSMYTEVDYTDKNLLLYLPMNEGEGATI
LHDVTGNGHDVEIGNSNLGNENRQKVTWETYSFAQ
Download sequence
Identical sequences Q8A8Y0
NP_809950.1.73244 WP_011107589.1.19130 WP_011107589.1.81417 WP_011107589.1.83447 APC81431 gi|29346447|ref|NP_809950.1| 226186.BT_1037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]