SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8AUM4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8AUM4
Domain Number 1 Region: 26-255
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.7e-64
Family Nuclear receptor ligand-binding domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8AUM4
Sequence length 258
Comment (tr|Q8AUM4|Q8AUM4_ORENI) Orphan nuclear receptor SHP {ECO:0000313|EMBL:AAN17673.1, ECO:0000313|Ensembl:ENSONIP00000008550} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=nr0b2 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MDSACRCSTSSDRTSNPILYNILSQMDGSRLSQGNFSYNSVPHRCKCEARRTVCLKRPSE
ICKEASAVLVKTLNFMKNLPAFNQLPPNDQFALLKSCWAPLFILGLAQERVDFEVTDIPT
DSMLKKILLNRPESPEVEREQPTMAGVSKLVSCLKKFWSLDLSPKEYAYLKGTTIFNPDV
PDLKAALFVEGLQQEAQQALSKVVQLLHPGDGDRFARILLTASMLQSITPSLITELFFRP
VIGQANLLELLVDMLFCR
Download sequence
Identical sequences Q8AUM4
ENSONIP00000008550 ENSONIP00000008550 NP_001266652.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]