SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8BH61 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8BH61
Domain Number 1 Region: 192-502
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.1e-117
Family Transglutaminase core 0.0000000000179
Further Details:      
 
Domain Number 2 Region: 9-191
Classification Level Classification E-value
Superfamily E set domains 1.92e-55
Family Transglutaminase N-terminal domain 0.0000000173
Further Details:      
 
Domain Number 3 Region: 517-628
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 8.77e-31
Family Transglutaminase, two C-terminal domains 0.00000531
Further Details:      
 
Domain Number 4 Region: 630-727
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 4.06e-28
Family Transglutaminase, two C-terminal domains 0.00000304
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8BH61
Sequence length 732
Comment (sp|Q8BH61|F13A_MOUSE) Transglutaminase A chain KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=F13a1; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MSDTPASTFGGRRAVPPNNSNAAEVDLPTEELQGLVPRGVNLKDYLNVTAVHLFKERWDS
NKIDHHTDKYDNNKLIVRRGQTFYIQIDFNRPYDPRKDLFRVEYVIGRYPQENKGTYIPV
PVVKELQSGKWGAKVIMNEDRSVRLSVQSSPECIVGKFRMYVAVWTPYGILRTRRDPETD
TYILFNPWCEEDAVYLDDEKEREEYVLNDIGVIFYGDFKDIKSRSWSYGQFEDGILDTCL
YVMDKAEMDLSGRGNPIKVSRVGSAMVNAKDDEGVLVGSWDNVYAYGIPPSAWTGSVDIL
LEYRSSETPVRYGQCWVFAGVFNTFLRCLGIPARVITNYFSAHDNDANLQMDIFLEEDGN
VSSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQAVDSTPQENSDGMYRCGPASVQAVKH
GHVCFQFDAPFVFAEVNSDLVYITAKQDGTHVVEAVDATHIGKLIVTKQIGGDGMQDITD
TYKFQEGQEEERLALETALMYGAKKTLNTEGVVKSRSDVTMNFDVENAVLGKDFKVTITF
QNNSSNLYTILAYLSGNITFYTGVSKKEFKKESFEETLDPFSSKKKEVLVRAGEYMSHLL
EQGFLHFFVTARINESRDVLAKQKSIILTIPKITIKVRGAAMVGSDMVVTVEFTNPLKET
LQNVWIHLDGPGVMRPKRKVFREIRPNTTVQWEEVCRPWVSGHRKLIASMTSDSLRHVYG
ELDLQIQRRPTM
Download sequence
Identical sequences Q8BH61
ENSMUSP00000048667 ENSMUSP00000048667 ENSMUSP00000128316 NP_001159863.1.92730 NP_083060.2.92730 ENSMUSP00000048667 10090.ENSMUSP00000048667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]