SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8BKV0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8BKV0
Domain Number 1 Region: 200-320
Classification Level Classification E-value
Superfamily EF-hand 5.68e-36
Family Osteonectin 0.0097
Further Details:      
 
Domain Number 2 Region: 289-382
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.05e-28
Family Thyroglobulin type-1 domain 0.00078
Further Details:      
 
Domain Number 3 Region: 138-183
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000236
Family Ovomucoid domain III-like 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8BKV0
Sequence length 436
Comment (sp|Q8BKV0|TICN3_MOUSE) SPARC/osteonectin, CWCV, and Kazal-like domains proteoglycan 3 KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Spock3; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MLKVSALLCVCAAAWCSQTLAAAAAVAVAGGRSDGGNFLDEKQWLTTISQYDKEVGQWNK
FRDEVEDDYFRTWNPGKPFDQALDPAKDPCLKTKCSRHKVCITQDAQTALCISHRRLTHS
MKEVGGSHKQWRGLPSSTCKPCPIAYASPVCGSDGHSYSSQCKLEYQACVLGKQISIKCE
GRCPCPSDKSMNIGRNVKRACSDLEFREVANRLRDWFKALHESGSQNKKTKALLRPERSR
FDTSILPICKDSLGWMFNRLDTNYDLLLDQSELGSIYLDKNEQCTKAFFNSCDTYKDSLI
SNNEWCYCFQRQQDPPCHTELSNIQKRQGIKKLLGQYIPLCDEDGYYKPTQCHGSVGQCW
CVDRYGNEVVGSRINGVADCAIDFEISGDFASGDFREWTDDEGEEDDIMNDKDDIEDDDE
DEGDDDDDGDVHDGYI
Download sequence
Identical sequences Q8BKV0
NP_001239549.1.92730 NP_076178.1.92730 ENSMUSP00000091192 ENSMUSP00000112930 ENSMUSP00000113683 ENSMUSP00000112930 10090.ENSMUSP00000113683 ENSMUSP00000091192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]