SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8BM26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8BM26
Domain Number 1 Region: 22-150
Classification Level Classification E-value
Superfamily Lysozyme-like 1.23e-48
Family C-type lysozyme 0.00000434
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8BM26
Sequence length 151
Comment (tr|Q8BM26|Q8BM26_MOUSE) Lysozyme {ECO:0000256|SAAS:SAAS00814457} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=mCG_3390 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MKAPLTLLTLGLLLLSITIQGKVYDRCSLARTLQSLGLAGFQGITLANWVCLAKWESNFN
TNTTRFNPEDQSTSYGIFQINSRFWCNDGKTPGSRNFCRISCKALLKSNIWSAVVCAKRI
VKDPQGIYSWAGWIKHCKNKNLKEYIRGCHL
Download sequence
Identical sequences Q8BM26
ENSMUSP00000020392 ENSMUSP00000020392 NP_084182.2.92730 10090.ENSMUSP00000020392 ENSMUSP00000020392 ENSMUSP00000125436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]