SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8BMC3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8BMC3
Domain Number 1 Region: 99-284
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-56
Family Phosphotyrosine-binding domain (PTB) 0.000000182
Further Details:      
 
Domain Number 2 Region: 452-562
Classification Level Classification E-value
Superfamily SH2 domain 2.56e-28
Family SH2 domain 0.0000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8BMC3
Sequence length 573
Comment (sp|Q8BMC3|SHC2_MOUSE) Src homology 2 domain-containing-transforming protein C2 KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Shc2; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MTQGPGGRAAPEPEAPTTFCALLPRMPQWKFAAPGSFLGRGPAATRVAGVAEAQPEPGVP
ALAAVLGACEPRCAAPCPLPALGRCRGSGTRGARVTPDVADEWVRKGGFIHKPAHGWLHP
DARVLGPGVSYIVRYMGCIEVLRSMRSLDFNTRTQVTREAINRLHEAVPGVRGSWKKKAP
NKALASILGKSNLRFAGMSISVNISVDGLNLSVPATRQIIANHHMQSISFASGGDTDMTD
YVAYVAKDPINQRACHILECCEGLAQSVISTVGQAFELRFKQYLHSPPKAVVPPERLTGL
EELAWGDDDAAADHNYYNSIPGKEPPLGGLVDSRLAVTQPCALATLGGLGQGMTPVWRDA
RGLPWDMGPSGAAPPGDGYVQADARGPHDYEEHLYVNTQGLDAVELEDTAEAPLQFEDSP
KKDLFDMRPFEDALKLHACSVAAGITAASPPLEDQWPSPPTRRAPIAPTEEQLRQEPWYH
GRMSRRAAEKLLRADGDFLVRDSVTNPGQYVLTGMHAGQPKHLLLVDPEGVVRTKDVLFE
SISHLIDYHLKNGLPIVAAESELHLRGVVSREP
Download sequence
Identical sequences E9QLZ0 Q8BMC3
ENSMUSP00000129491 NP_001019710.1.92730 ENSMUSP00000129491 ENSMUSP00000020564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]