SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8BMN4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8BMN4
Domain Number 1 Region: 49-279,313-634
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.32e-144
Family Leishmanolysin 0.0000439
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8BMN4
Sequence length 681
Comment (sp|Q8BMN4|LMLN_MOUSE) Leishmanolysin-like peptidase KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Lmln; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MAAAGSGGAGGPGPGPRGRWGGCLWVRGVLLVLGGLPAGAGAAPVSLGTSPPCRHHVLSD
TEVINKVHLKTNHVTKRDADGHLRIKTIYDQSIEELLPEKRYLVKNKLFPQAISYLEKTF
QVRRPAGRILLSRQCATNQYLRKENDPHRYCTGECAVHTKCGPVIVPEEHLQQCRVCREG
KWPCGAVGVLDPEGVRDADFVLYVGALATERCSHENIISYAAYCQQEAKMDRPIAGYANL
CPNMISTQPQEFIGMLSTVKHEIIHALGFSAGLFAFYHDQDGNPLTSRSADGLPPFNYSL
GLYQWSDKVVRKVERLWNVRDNKIVRHTVYLLVTPRVVEEARKHFNCPVLEGMELENQGG
MGTELNHWEKRLLENEAMTGSHTQNRVLSRITLALMEDTGWYKANYSMAEKLDWGRGLGC
EFVRKSCKFWIDQHRQRRQVPSPYCDTLRSNPLQLTCRQDQRAVAVCNLQRFPNPLPPEY
QYFDELTGIPAEDLPYYGGSVEIADYCPFSQEFSWHLSGEYQRSSDCRILENQPELFKNY
GAEQYGPHSVCLLQKSAFIMEQCERKLSYPDWGSGCYQVSCSPQGLKVWVQDTSYLCSRA
GQVLPVRIQMNGWIHNGNLLCPSCWDFCEQCPPETDPPAANLTRALPLDLCSCSSSLVVT
LWLLLGNLFPLLAGFLLCVWH
Download sequence
Identical sequences Q8BMN4
ENSMUSP00000023497 ENSMUSP00000023497 ENSMUSP00000023497 NP_766411.1.92730 10090.ENSMUSP00000023497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]