SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8BYM1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8BYM1
Domain Number 1 Region: 4-124
Classification Level Classification E-value
Superfamily Globin-like 2.86e-34
Family Globins 0.0000237
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8BYM1
Sequence length 145
Comment (tr|Q8BYM1|Q8BYM1_MOUSE) MCG68017 {ECO:0000313|EMBL:EDL23756.1} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=mCG_68017 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MARSQDDQWLVLALWKKMGSNVGIYTTEALERTFVAFPSTKTYFPHLDLRPGSSQVKAHA
QKVADALTLATQHLDDLPASLSALSDLHAHKLCVDPANFQFFSCCLLVTLARHYPGDFSG
EKDACLLGHVSGSCDFCTGLQVMLN
Download sequence
Identical sequences Q8BYM1
ENSMUSP00000020535 NP_778165.1.92730 ENSMUSP00000020535 10090.ENSMUSP00000020535 ENSMUSP00000020535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]