SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8BZ05 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8BZ05
Domain Number 1 Region: 1123-1298
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.86e-41
Family BCR-homology GTPase activation domain (BH-domain) 0.00058
Further Details:      
 
Domain Number 2 Region: 684-799
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.26e-34
Family Pyk2-associated protein beta ARF-GAP domain 0.0017
Further Details:      
 
Domain Number 3 Region: 445-571
Classification Level Classification E-value
Superfamily PH domain-like 9.06e-22
Family Pleckstrin-homology domain (PH domain) 0.0000166
Further Details:      
 
Domain Number 4 Region: 917-1037
Classification Level Classification E-value
Superfamily PH domain-like 1.84e-20
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 5 Region: 1421-1564
Classification Level Classification E-value
Superfamily PH domain-like 2.83e-20
Family Phosphotyrosine-binding domain (PTB) 0.082
Further Details:      
 
Domain Number 6 Region: 4-75
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.75e-17
Family SAM (sterile alpha motif) domain 0.0000631
Further Details:      
 
Domain Number 7 Region: 584-683
Classification Level Classification E-value
Superfamily PH domain-like 8.05e-16
Family Pleckstrin-homology domain (PH domain) 0.034
Further Details:      
 
Domain Number 8 Region: 1014-1114
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000295
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8BZ05
Sequence length 1703
Comment (sp|Q8BZ05|ARAP2_MOUSE) Centaurin-delta-1 KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Arap2; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MSSVSEVNADIRDFLMSINLEQYLLHFREFGFYTVRDCTSINDSVLHQIGISPTGHRRRI
LKQLQMIFSKMQDFPIYANVHKAKNGSTTKEQQHSDPSSSTHTGIECSDSITVHRPGPAP
SEMVTTSTLSEGNCQSPKSHDKLCLSSHDLLCPEEELHQNVDSSKDSLFGGVNVKIDPLI
TKRAVEYTAGEEHTEKGNLTSEDSSKALSTNTECLPSGDCPTSGTHSGNGTNGVLESFPP
TPFFQFQGEMVVNELYVPSSPVHGPMRSRSKLVSRPSRSFLLRHRPVPEIPGSTKSIPGS
YFRDRRSNTTSAGKSLTLKNSNEDNSTSIFPYGETFLFQRLESSKKRSIKNEFWPHENTV
KEEAATTRNSILTQSSIYDNRKEKVSEDKVEDIWIPREDKNNLAQDSASESEYSTVEECF
QSLRRKNSKASKSRTQKAFYLDPFNRHSYPLSSTSGNTEPSSTISNAISPYACFYGSSAA
KEKCGWLDKLSPQGKRMFQKRWVKFDGLSISHYNNDREMYSKGIIPLTAISTVRAQGDNK
FEIVTTQRTFVFRVEKEEERNDWISILLSALKSPSLASQLQAAVAPEKCGYLELRGYKAK
IFTVLRGNSVWLCKNEQDFKSGLGITIIPMNVANVKQVDRAVKQSFEIITPYRSFSFTAD
SEREKQEWIEAVQQSIAETLSDYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVICKK
CAGQHRSLGPKDCKVRSLKMDASIWSNELIELFIVIGNKRANDFWAGNLQKDEELQVDSP
VEKRKNFITQKYKEGKFRKTLLASLTKEELNKALCAAVVKPDVLETMALLFSGADVMCAT
GDPVHSTPYLLAKKAGQSLQMEFLYHNKFSDFPQYDAHFEGGSSQDAAQSSFLCDFLYQT
AAAASRVSSEKKLLEDTNKKWCVLEGGFLSYYENDRCTTPNGTINISEVICLAVHKEDFY
LNTGPIFVFEIYLPSERVFLFGAETSQIQRKWTETIAKRFVPFVAENLTEADYDLIGQLF
YKDCHALDQWRKGWFAMDKSSLCFCLQTQEAQEERMNLRRLQELTISTMVQNGEKVDVLL
LVEKGRTLYIHGHTKLDFTVWHTAIEKAAGTDGNALQDQQLCKNDVPIIVNSCIAFVTQY
GLGCKYIYQKDGDPLHISELLESFKKDARSVKLRAGKHQLEDVTGVLKSFLSDIDDALLT
KELYPYWVSALDTQDEKERTSKYRAFIRSLPGVNRATLAALIEHLYRVQKCSEINHMNAH
NLAMVFSSCLFQTKGQTSEEVNVIEDLINNYVEIFEVKEDQVKQMDIENSFITKWKDTQV
SQAGDLLIEVFVERKEPDCSIIIRISPVMEAEELTNDILAIKNIIPMKGDIWATFEVIEN
EELERPLHYTENVLEQVLQWSSLAEPGSAYLVVKRFLTVDSIKQCREKSIKEGILKLKEE
PSKILSGNKFQDRCVVLRDGHLFIYKDPKSSKHDKMFPLRAMKFYLGVKKKMKPPTSWGL
TVYSEKHHWHLCCDSLQAQMEWMASIFIAQHENDIWPPAGKERKRSITKNPKIGGLPLIP
IQHERNATQARKNIETARAELERLRLSEKHDPRDFTDSSLKDRASLIAHCLEHKDEKLRN
RARKHRSFNCLEDTEAEGPHGLPKAYKGPKTLKKTEERNSKATLDADPKLPSKVIEELSV
VLQRSRPLHKELPDEQTLQKEVK
Download sequence
Identical sequences Q8BZ05

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]