SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8DGG9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q8DGG9
Domain Number - Region: 10-61
Classification Level Classification E-value
Superfamily Chaperone J-domain 0.000867
Family Chaperone J-domain 0.0072
Further Details:      
 
Domain Number - Region: 100-146
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.00219
Family Pyruvate oxidase and decarboxylase Pyr module 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8DGG9
Sequence length 210
Comment (tr|Q8DGG9|Q8DGG9_THEEB) Tlr2348 protein {ECO:0000313|EMBL:BAC09900.1} KW=Complete proteome; Reference proteome OX=197221 OS=Thermosynechococcus elongatus (strain BP-1). GN=tlr2348 OC=Thermosynechococcus.
Sequence
MSKDQFAMSDNPYEKLQVPEDASFEQIKEARDALLAAHSGDERQRTEIEAAYDAILMDRL
RQRQEGKIKVPERIRYAEELKEPAPAKLNRIANHPALQWWQQQLDTPNLRGIAITSTIYA
VLMAIGLAQANPDTLALVLSLGVGFNLVWLQRKEQRLGRAFLITLLALILGSVMAVGLYQ
LGLPGVFLTVDQLVGIGVFVTFWLTSNFLR
Download sequence
Identical sequences Q8DGG9
gi|22299891|ref|NP_683138.1| 197221.tlr2348 NP_683138.1.97157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]