SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8DHT4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q8DHT4
Domain Number - Region: 2-42
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00329
Family Transcriptional factor domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8DHT4
Sequence length 162
Comment (sp|Q8DHT4|NRDR_THEEB) Transcriptional repressor NrdR {ECO:0000255|HAMAP-Rule:MF_00440} KW=Complete proteome; Reference proteome OX=197221 OS=Thermosynechococcus elongatus (strain BP-1). GN=tlr1861; OC=Thermosynechococcus.
Sequence
MQCPYCHHTDSRVLESRSAEGGQSIRRRRECLACGRRFTTYERIEFVPITVIKRNGDRES
FDRSKLLRGIMTACGKTNIPQQKIEALVDDIEADLQLRSRREVTSAELGEAALQRLRHLS
EVAYVRFASVYRQFQGISDFVAELAHLQETPASPELLTISQS
Download sequence
Identical sequences Q8DHT4
NP_682651.1.97157 gi|22299404|ref|NP_682651.1| 197221.tlr1861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]