SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8DHU9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8DHU9
Domain Number 1 Region: 50-344
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.24e-37
Family TK-like PP module 0.0058
Further Details:      
 
Domain Number 2 Region: 380-583
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1e-30
Family TK-like Pyr module 0.029
Further Details:      
 
Domain Number 3 Region: 592-740
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000241
Family Transketolase C-terminal domain-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8DHU9
Sequence length 741
Comment (tr|Q8DHU9|Q8DHU9_THEEB) Tll1846 protein {ECO:0000313|EMBL:BAC09398.1} KW=Complete proteome; Reference proteome OX=197221 OS=Thermosynechococcus elongatus (strain BP-1). GN=tll1846 OC=Thermosynechococcus.
Sequence
MHSRVGSGSMTAVTSVPRFCEGIQYFGNDWPDWDRYGQRPLLSTQQPALTDLEAPEAAYQ
TLLYADALRYLILQMTGSKASGHPGGFASQAEAYAALVMLGHKNIITEVGHHAPGFYAAL
FLDRSLEKMGIYTVQDLRDRFREKHGLLGHLSGYIPGVLAPAGPLGQGQHFAMAAAWLHR
QTLFPFTLGDGGLGEPYVMSSMAHFHTAFPEVTNFLPVLVWNGFSQEHHSMVSRKTNPEM
MAYWHGNGFQEVVLVDAKDFDDSGQEGDYVDSTQFSFGQRLAFVQAVLKGMQEAARSALA
GNLTVFILKQLKGAGVHAKGAKSHNLYAQHTLDNPDIVNALKARALSPAAWELVRQNSVA
AAGGPAAEVVVTEQVLDLPPLGEIALEAYALGESKVATTAMGRMVAEVGQRDRRYLVTNA
DGNEASGIGNINQALKIIHPTTDPLYNQVPNGQVYEPLSEDACAGLAAGLCLMGSRSLWC
SYESFAINGLPIWQTVTQAMAELRRPTPSTVTLFTAGALEQGRNGWTHQRPEIEAYYGAL
LRNGNIFVLFPPDANSIQVCYRWALTTQNKGIAIFASKTPLPVRTTFAQTEQALNEGAVT
LYESASGGSTLVLAVLGDMILQPVYSALPQLEQLGYRVRIVSVINPRRLYRPMDVAWHTC
AEPDGGFADETTFQRLFDGDALLGVTGGASALLEPVLLRATCPRDLLAWQRGETTASAAE
LMAYNGLTPEAICDRARSLLK
Download sequence
Identical sequences Q8DHU9
gi|22299389|ref|NP_682636.1| NP_682636.1.97157 197221.tll1846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]