SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8DHW9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8DHW9
Domain Number 1 Region: 362-543
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.68e-62
Family Pyruvate oxidase and decarboxylase PP module 0.0000604
Further Details:      
 
Domain Number 2 Region: 7-180
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.05e-55
Family Pyruvate oxidase and decarboxylase Pyr module 0.0000282
Further Details:      
 
Domain Number 3 Region: 186-367
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 3.89e-43
Family Pyruvate oxidase and decarboxylase, middle domain 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8DHW9
Sequence length 552
Comment (tr|Q8DHW9|Q8DHW9_THEEB) Acetolactate synthase {ECO:0000313|EMBL:BAC09376.1} KW=Complete proteome; Reference proteome OX=197221 OS=Thermosynechococcus elongatus (strain BP-1). GN=ilvB OC=Thermosynechococcus.
Sequence
MPAIAHPMNTAELLVKCLENEGVEYIFGLPGEENLDVLHALHRSRIQFITTRHEQGAAFM
ADVYGRLTGKAGVCLSTLGPGATNLMTGVADANLDGAPLVAITGQVGTDRMHIESHQYLD
LVAMFSPVTKWNAQIVRPSITPEIVRKAFKIAQNEKPGAVHIDVPENIAAMEAEGAPLKP
SSPEKTYASFQSILKAAELINAAENPLILVGNGAIRAHAAAALTHFAEKLNIPVANTFMG
KGVIPYQHPLALWTVGLQQRDYISCGFDHADLVIAVGYDLIEYSPKSWNPEGRLPIIHIA
ATPAEIDSSYIPVVEVVGDISDSLYEILKRADRQDKPTPYAVQLRQEIVADYYQYAQDES
FPVKPQKLIYDLRQVMGPEDIVISDVGAHKMWIARHYHCDRPNTCLISNGFAAMGIAVPG
AMAAKLVYPQRHVVAVTGDGGFMMNFQELETALRMGTNFTTIIFNDGGYGLIEWKQQRYF
GESAYVHFSNPDFVKLAESMGLKGYRIEETTDFIPTLKTALAQNVPTLIDVPVDYSENLR
FNQRLGELSCTP
Download sequence
Identical sequences Q8DHW9
197221.tll1824 gi|22299367|ref|NP_682614.1| NP_682614.1.97157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]