SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8DI18 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8DI18
Domain Number 1 Region: 393-572
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.85e-42
Family N-acetylmuramoyl-L-alanine amidase-like 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8DI18
Sequence length 577
Comment (tr|Q8DI18|Q8DI18_THEEB) N-acetylmuramoyl-L-alanine amidase {ECO:0000313|EMBL:BAC09326.1} KW=Complete proteome; Reference proteome OX=197221 OS=Thermosynechococcus elongatus (strain BP-1). GN=tll1774 OC=Thermosynechococcus.
Sequence
MNGVSLSFLSAVIVGSLQPATAQGSLQVVYPPRQHTTSAPQIFFIGTAPPQVAVTLNGQV
IGDRSPAGHFAPSIPLQPGLNRITLQAGDQRLEFAITRTVPEIPTSPQPLEPTADLVRLP
NDIVCFTAAAPGDRAVEVQVGQHLLPLEPLPPQVQLPSNLAALIDQADGVTARPSLYRNC
LQLTQVGDYGPIQWRFASQRQLGARIRVAEPTHLPVVEVNRPFGGVARTGPSTDYSRLTP
LPVGTRARVRGQTGDWLHLDYGGWIRADEVRFLSSALPTTATIRSITSRQRSGWTEISFP
LDVPVPISIQQGDRQFTLTLHNTIPQTDIIRVDTDPVIQRLDWSPLDQQRVEYRFTLHHR
QQWGYRVAYEGNRLLLQLRHPPQLQQGTQPLRGIKILIDPGHGGPEDLGARGPDGTPEKV
VTFTLAKKLAPELERLGATVILTRTEDIDLDLLDRSLAIESAQPTLALSLHYNALPDAGD
ARNTQGIGAFWYHPQSHDLAVFLGNYLSQQLRRPQYGVFWNNLALTRPTIAPAVLLELGF
MIHPEEFEWIVNPQAQGELARTLAQGLLKWLQQATRP
Download sequence
Identical sequences Q8DI18
197221.tll1774 NP_682564.1.97157 gi|22299317|ref|NP_682564.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]