SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8DJQ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8DJQ3
Domain Number 1 Region: 16-341
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.22e-101
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.000000912
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8DJQ3
Sequence length 342
Comment (tr|Q8DJQ3|Q8DJQ3_THEEB) Pyruvate dehydrogenase E1 component subunit alpha {ECO:0000256|RuleBase:RU361139} KW=Complete proteome; Reference proteome OX=197221 OS=Thermosynechococcus elongatus (strain BP-1). GN=tlr1169 OC=Thermosynechococcus.
Sequence
MVQERSLPSLSIPQTAITREQGLMLYEDMVLGRTFEDKCAEMYYRGRMFGFVHLYNGQEA
VSTGVIKAMRPDDYVCSTYRDHVHALSAGIPAREVMAELFGKATGCSKGRGGSMHLFSAK
HNFLGGFAFVAEGIPVATGAAFQTLYRRQVMGDAKADQVTACFFGDGASNNGQFFECLNM
AALWKLPILFVVENNKWAIGMAHERASSETEIYKKAKVFGMVGEEVDGMDVLAVRTVAEA
AIARARAGEGPTLIEALTYRFRGHSLADPDELRSKEEKEFWLKRDPIKKLGAYLVEQELA
TGEDLRAIEQKVQAIVEDAVTFAEQSPEPKPEELYDYIFADE
Download sequence
Identical sequences Q8DJQ3
gi|22298712|ref|NP_681959.1| 197221.tlr1169 NP_681959.1.97157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]