SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8DMI6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8DMI6
Domain Number 1 Region: 5-176
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.87e-36
Family Pyruvate oxidase and decarboxylase Pyr module 0.0036
Further Details:      
 
Domain Number 2 Region: 374-547
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.31e-22
Family Pyruvate oxidase and decarboxylase PP module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8DMI6
Sequence length 562
Comment (sp|Q8DMI6|MEND_THEEB) 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase {ECO:0000255|HAMAP-Rule:MF_01659} KW=Complete proteome; Reference proteome OX=197221 OS=Thermosynechococcus elongatus (strain BP-1). GN=tll0130; OC=Thermosynechococcus.
Sequence
MILTENLNVLWASVLFETLYRLGLRTVVLSPGSRSGPLAIAAAAHPHLEALPILDERSAA
FFALGLVQQQGRPVALLCTSGTAAANFYPAIIEASLSHLPLIVLSADRPPELRFCQAGQA
IDQVHLYGHAVRHYRELSLPELPLLPYLRQTLCHSWQTALWPDPGPVHLNIPLRDPLDLR
SQANFHGELPKGFFDQVQPFVPPRVVTSLPWQTWQQMQRGLIIAGPSHGVDPLAEAAAID
RLSRFLQWPVLADALSSARGLPHGISHYDLLLRDAHLREYLRPEAVIQLGPLPTSKALRE
WLSACDPLIWCLDPTGDNNNPLHGRCQMLAIAPQAVDCPPDPLPPNPYLKDWQDQDQRVR
EQLKRTFEAIDWFSEVKLIYHLPQWLPSQTAIFVASSMPVRDVESVWQGSDRRHRFYFNR
GANGIDGTLSTALGVAHRGQPTLLITGDLACLHDTNGWLITPQFQGCLTVLLINNRGGGI
FEHLPIRQFDPPFEAFFATPQQVDFSYLAAAYGIPYHCLKDWADVEAQLRQTPWPKIRLL
EFRSDRHRNAQWRQQVLAHLGG
Download sequence
Identical sequences Q8DMI6
NP_680921.1.97157 197221.tll0130 gi|22297674|ref|NP_680921.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]