SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8DMJ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8DMJ1
Domain Number 1 Region: 34-116,206-426
Classification Level Classification E-value
Superfamily Pectin lyase-like 8.29e-28
Family Pectin methylesterase 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8DMJ1
Sequence length 513
Comment (tr|Q8DMJ1|Q8DMJ1_THEEB) Tlr0125 protein {ECO:0000313|EMBL:BAC07678.1} KW=Complete proteome; Reference proteome OX=197221 OS=Thermosynechococcus elongatus (strain BP-1). GN=tlr0125 OC=Thermosynechococcus.
Sequence
MKGQPLLFILLVMVLFLMGQPKIAAISASPLALEVNPADPQASDVGKGMPLTPFRTIGAA
LAWAQAHDRPIDIYIHGGIYREALGAIRHRQTPLRLLAKAGDRVILRGSQRWSDWQAVSS
TPNFTIYRHPWTLAWGFSGNPWTAFDIDLPPVAQRGELVWWQKTPLRQRLSFLELQGNDF
YVDDTEQQLYVALPAGVLPSELEVAVHREALRILNSGLISLVGLRFEHYGGTFTQAVRIE
RSHDIEVKDCTFWANNWGGLESHQSNRLRVERTQFLQNGWRGMAGVHLQDFTVQQVLVQG
NNWRGGWAGFYDWDAGEKYFHLRRAVFDHYRAIGNQAAGLWLDTDNQNVKIRRSQFVGNA
VVGLFLEAGTGPVTIEDSLIAYNYSVAPNYLQTPGIFGWAAAHVTLRRNWIWQNQGAQIG
VRDLSPRTLTLPETGEEVTIRSQDWHLEGNWIGSHQEPLLTTLKGEAFLQTLRLEDNHWW
SHAPYPFRLEGENVTWSQWQERYGHPSDRWLLP
Download sequence
Identical sequences Q8DMJ1
197221.tlr0125 NP_680916.1.97157 gi|22297669|ref|NP_680916.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]