SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8E983 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8E983
Domain Number 1 Region: 34-106
Classification Level Classification E-value
Superfamily Coronavirus S2 glycoprotein 0.000023
Family Coronavirus S2 glycoprotein 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8E983
Sequence length 217
Comment (tr|Q8E983|Q8E983_SHEON) Uncharacterized protein {ECO:0000313|EMBL:AAN57370.2} KW=Complete proteome; Reference proteome OX=211586 OS=Shewanella oneidensis (strain MR-1). GN=SO_4403 OC=Shewanellaceae; Shewanella.
Sequence
MKRLITSSLIAATLLLTGCQTAYYGAMEKVGYHKRDIMVDRVKAAKESQEDAQKEFSSAL
EEMQALLNHNGGNLEKAYNKAKDEYESAQSAADDVSNRINKVEDVAEALFDEWQTEIAEI
SKASLRRNSETKLKETRRSYEQLIKTMRRAESKMPPILTAMKDNMLYLKHNLNAQAIGAI
KGEFASLQTDISGLIKEMNKSINESTRFIEALENAKG
Download sequence
Identical sequences Q8E983
gi|414562276|ref|NP_719926.2| NP_719926.2.27637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]