SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8I399 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8I399
Domain Number 1 Region: 136-261
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000121
Family Thioltransferase 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8I399
Sequence length 281
Comment (tr|Q8I399|Q8I399_PLAF7) Uncharacterized protein {ECO:0000313|EMBL:CAD51735.1} KW=Complete proteome; Reference proteome OX=36329 OS=Plasmodium falciparum (isolate 3D7). GN=PF3D7_0905000 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MLKSCKMLRILYFNKIITKGLCSKGFIYKRLCFRNFNSIIKSEKKVDNKYIYNVYKLNDI
YYNNLKIINTYDEFYNLIIKNEYFKDYTQIRNRFCKEKDDIINNENTCDDTLYSDKNIMG
KKNTILNDAANKRIEEDSDKNIINSNDLQVLYFGCYDNNNSIILFNKFKSIIEKNKKLQF
YFIDVNLCPQGSYNCNIIFVPTIMLIYKNHIYRKKLEINYDQPVDDNYLNDFLSKVQQSI
DYFHKYNNKYIYSLKKQSNYLNTKYIDIDNQNIHKENWNTF
Download sequence
Identical sequences A0A024VXD0 A0A024WSC8 A0A024XAL7 A0A0L7K5K6 Q8I399 W4IIU6 W4J4F3 W7ESR9 W7FJ01 W7K5S8
gi|124506653|ref|XP_001351924.1| gi|23504951|emb|CAD51735.1| PFI0245c XP_001351924.1.26446 PFHG_00104T0 5833.PFI0245c-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]