SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8I3H6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8I3H6
Domain Number 1 Region: 81-167
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000626
Family Thioltransferase 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8I3H6
Sequence length 183
Comment (tr|Q8I3H6|Q8I3H6_PLAF7) Thioredoxin-like protein, putative {ECO:0000313|EMBL:CAD51652.1} KW=Complete proteome; Reference proteome OX=36329 OS=Plasmodium falciparum (isolate 3D7). GN=PF3D7_0529100 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MFCPFMFLLKIILIILFIKYNVVNGLLKTPCNFSLRNNIISERICNIKLPNLSYKNILFS
RYGRRRRRNMNPFLFIQFKEKKKLPHLLCFHSKDCEYCNSMEKLLTKLKEEEQVHILKLE
MYDNSYNFELLQQLDYNNLCGGLPYYYNLKTHYNICGATTYHNLRNWAIDKKCNPNEPPN
EEF
Download sequence
Identical sequences A0A2I0BUD6 Q8I3H6
gi|124506495|ref|XP_001351845.1| gi|23504871|emb|CAD51652.1| PFE1450c 5833.PFE1450c-1 XP_001351845.1.26446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]