SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8I5T2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8I5T2
Domain Number 1 Region: 43-204
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.17e-50
Family Glutathione peroxidase-like 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8I5T2
Sequence length 205
Comment (tr|Q8I5T2|Q8I5T2_PLAF7) Glutathione peroxidase {ECO:0000256|RuleBase:RU000499} KW=Complete proteome; Reference proteome OX=36329 OS=Plasmodium falciparum (isolate 3D7). GN=PF3D7_1212000 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MFFSMFIKFILPISFICYNFGKKFNMFSYFQKIKVSEQELLSSIYDYEVKDLSGSNVSMS
KFKNKVLIIFNSASKCGLTKNHVEQFNKLHEKYNARGLEILAFPTSQFLNQEFDNTKDIC
TFNEKNKIKYNMFSPIEVNGDNTHPLFKYLKKNCDSMHDENGTLKSIGWNFGKFLVDKNG
EVVNYFSPKTNPLDLEKIIIQLLQK
Download sequence
Identical sequences A0A024VNQ3 A0A024WNL5 A0A024X5R4 A0A2I0BYP3 Q27742 Q8I5T2 W4IDL5 W7F4V6 W7JKN3
PFL0595c 5833.PFL0595c-1 gi|124805752|ref|XP_001350528.1| gi|23496652|gb|AAN36208.1| XP_001350528.1.26446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]