SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8I8Q0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8I8Q0
Domain Number 1 Region: 31-147
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 2.88e-26
Family Insect pheromone/odorant-binding proteins 0.01
Further Details:      
 
Domain Number 2 Region: 152-260
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 2.09e-16
Family Insect pheromone/odorant-binding proteins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8I8Q0
Sequence length 320
Comment (tr|Q8I8Q0|Q8I8Q0_ANOGA) Odorant-binding protein AgamOBP32 {ECO:0000313|EMBL:AAO12070.1} KW=Complete proteome; Reference proteome OX=7165 OS=Anopheles gambiae (African malaria mosquito). GN=AgaP_AGAP000638 OC=Culicidae; Anophelinae; Anopheles.
Sequence
MISIELKYITLACVLAATVTAGSHCHNDYYQLKSVSQAQEECARYQGIPCARLAVYNKYI
YPNDTQTQCMVRCMGLNLGWWNDTHGVQEPAMRSFFHPDPDDCDYERRTYHCLNSQRLNH
PSPHVDVCERAYESFRCYYEQYGNIVVTPQFVPLSDLQQVDVLLQCANMLPLTVGRSCAG
GSKPSERDVDCLARCFLLRSGLYSEQHGPHLDRLYVQCNNYANETRFRETTGTCYRRLKS
ECQDECVLAGRFLRECFYEGGISIVNSLPASEASVESAGSLGSGQGSAELGESHQEKVLQ
TWKDLYDRENLQDLWDRQEL
Download sequence
Identical sequences Q8I8Q0
AGAP000638-PA AGAP000638-PA|odorant 7165.AGAP000638-PA XP_311165.1.40869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]