SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8I8Q4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8I8Q4
Domain Number 1 Region: 32-140
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.000000000000157
Family Insect pheromone/odorant-binding proteins 0.012
Further Details:      
 
Domain Number 2 Region: 149-255
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.000000144
Family Insect pheromone/odorant-binding proteins 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8I8Q4
Sequence length 336
Comment (tr|Q8I8Q4|Q8I8Q4_ANOGA) Odorant-binding protein AgamOBP38 {ECO:0000313|EMBL:AAO12064.1} KW=Complete proteome; Reference proteome OX=7165 OS=Anopheles gambiae (African malaria mosquito). GN=AgaP_AGAP000580 OC=Culicidae; Anophelinae; Anopheles.
Sequence
MLTYRAWLLLALLGAQCALILGAPATGHGYDTKSFAQAYLECLRYLNISRQSLYAYDSAA
VPLNCGSNCLLRCIGLNARWWHDETGLSERALVRFFRQAPADSLLQARACVAELPAPPAD
SCAGAYWSFRCYSDALGELIAHPAYVAPCGQEIRRAVSDCATMLQVEDGQLQTCVRTETF
LRQGNGAALLRCVVLRLGLYADSTGVLCDRVRLLMDADTAEQWTVARAEEAKRCEEDLRA
LGADTCVVAAHAVELCYGWPAFGELWEVLKQEYGSSDDALAEESEQVVVRRSCTPWMRPL
KMGRNRQKARPRRMRKSSCLKMLNRPNWTWQTGRSR
Download sequence
Identical sequences Q8I8Q4
XP_310492.1.40869 7165.AGAP000580-PA AGAP000580-PA AGAP000580-PA|odorant

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]