SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8I956 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8I956
Domain Number 1 Region: 598-944
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.35e-67
Family Duffy binding domain 0.00021
Further Details:      
 
Domain Number 2 Region: 1037-1253
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.84e-52
Family Duffy binding domain 0.00069
Further Details:      
 
Domain Number 3 Region: 2-283
Classification Level Classification E-value
Superfamily Duffy binding domain-like 8.76e-51
Family Duffy binding domain 0.00058
Further Details:      
 
Domain Number 4 Region: 316-524
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.09e-32
Family Duffy binding domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8I956
Sequence length 1253
Comment (tr|Q8I956|Q8I956_PLAFA) Erythrocyte membrane protein 1 varPAM {ECO:0000313|EMBL:AAN86341.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN= OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
LARSFADIGDIVRGKDLFLGAPNKEKIKLEENLKKIFDNIKNENAELSKLSLEKVREYWW
AIHRKELWEALTCSAPKGANYFVYKLDRPKFSSDRCGHNYNGDPLTNLDYVPQYLRWFDE
WGEEFCRKRKIKLENVEKACRKDSEKLYCRHNGYDCTKTIKNENILFDDPKCTDCLIKCS
LYEIWLDNQQKEFEKQKEKCEKEIQTYISNNEISNNNISNEYNKQISEKYTDKKYETLDK
FLNLLKEGKYCKERMTGESSIDFNNDVDKTFSYSKHCKVCPHCEVDCENGNCEVKNKPDG
NCGKNVKYKPPYGVKPTEITVLYSGNEKGDISKKLSEFCSNKNNINVKNNETWKCYYKNS
DNNKCKMESNSENNKGAEKITSFHEFFELWVKNLLKDTMKWENEIKDCINNTNITDCNDE
CNKNCVCFDKWVKQKEEEWKNVKKVFENKKYIQDKYYLDINKLFESFLFKVISELDQGEA
KWNQLKEELKKKIESSKANEGIKDSESAIELLLDHLKESATTCKDNNANEACSSSQKSSP
NPCADKSGGKLVSVKPIAQYIKRQAYDQANYRSDGLHKLKGKAHEGKYKRKGRENYFKAK
LCKIGKYHSNRDPFESKGPCYGKDGNKLSFQIGTDWKGAEEEKMIYNDVYLPPRREHMCT
SNLEHLVTDNKPLDGTDGNPKLVNNSFLGDVLLSAKYEAQRTKEDYEPVSDEQSICRAVR
YSFADLADIIRGRDMWDKDDGAQKMERILKSIFKNIYETIGDKKGKYTNTDGKYLELRED
WWEANRAKVWEAMKCAIKGLNVTSSDGKLSDHCGYSDHTPLDDYIPQKLRWMAEWAEWYC
KVQSQEYDKLKKSCVMCMQKDNGKNCWKHNSECGVCKGACTAYQGKLLPWEYQWNVISHK
YETLYEKARIAADNGGLDTSSGDIDPKDKTLVEFLFNLYVQNGGKIGTIGTTGDKDTRDT
TPTVYSTAAGYIHEEAHIGDCKKQKQFCEKKNGAKPPSGDLEVDNEYAFRDKPTDHDKVC
DCESGEKLQYKKKEGIVLEEPCNVVKTLLKDKNEKSDIGQCIRKYKDGNEKYPVWDCTRN
KIKIGEGAYMPPRRQKLCVDFLKQLKDQTDEKLRDAFIKSAAAETFLSWHKYKEDTQKEK
ATHTADNDLNKGIIPEDFIRQMYYTFGDYRDLCMNKNIGNDVSNVESKIEGVFSKADGTS
SSNLSREVWWKKHGPKIWEGMLCALPGTENFKNKADYKNPPEDFAKQPQFLRW
Download sequence
Identical sequences Q8I956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]