SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8I957 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8I957
Domain Number 1 Region: 598-944
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.62e-65
Family Duffy binding domain 0.00021
Further Details:      
 
Domain Number 2 Region: 1038-1255
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.44e-51
Family Duffy binding domain 0.00079
Further Details:      
 
Domain Number 3 Region: 2-283
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.49e-51
Family Duffy binding domain 0.00056
Further Details:      
 
Domain Number 4 Region: 316-524
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.44e-29
Family Duffy binding domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8I957
Sequence length 1255
Comment (tr|Q8I957|Q8I957_PLAFA) Erythrocyte membrane protein 1 varPAM {ECO:0000313|EMBL:AAN86340.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN= OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
LARSFADIGDIVRGKDLFLGAPNKEKIKLEENLKKIFDNIKNENAELSKLSLEKVREYWW
AIHRKELWEALTCNAPKGANYFVYKLDGPKFSSDRCGHNYNGDPLTNLDYVPQYLRWFDE
WGEEFCRKRKIKLENVEKACRKDSEQLYCRHNGYDCTKTIKNENILFDDPKCTDCLIKCS
LYEIWLDNQQKEFEKHKEKYKKEIPTYISNKEISNNNISNEYIKQISEKYTDKKYETLDK
FLNLLKEGKYCKERMTGESSIDFNNDVDKTFSYSKHCKVCPHCKVDCENGNCEVKNKPDG
NCGKNVKYKPPYGVKPTEITVLYSGNEKGDISKKLSEFCSNKNNINVKNNETWKCYYKNS
DNNKCKMESNSENNKGAEKITSFHEFFELRVKNLLKDTMKWENEIKDCINNTNITDCNDE
CNKNCVCFDKWVKQKEEEWKNVKKVFENKKYIQDKYYLDINKLFESFLFKVISELDQGEA
KWNQLKEELKKKIESSKANEGIKDSESAIELLLDHLKESATTCKDNNANEACSSSQKSSP
NPCADKSGGKLVSVKPIAQYIKRQAYDQANYRSDGLHKLKGKAHEGKYKRKGRENYFKAK
LCKIGKYHSNRDPFESKGPCYGKDGNKLSFQIGTDWKGAEEEKMIYNDVYLPPRREHMCT
SNLEHLVTDNKPLDGTDGNPKLVNNSFLGDVLLSAKYEAQRTKEDYEPVSDEQSICRAVR
YSFADLADIIRGRDMWDKDDGAQKMERILKSIFKNIYETIGDKKGKYTNTDGKYLELRED
WWEANRAKVWEAMKCAIKGLNVKSSDGKLSDHCGYSDHTPLDDYIPQKLRWMAEWAEWYC
KVQSQEYDKLKKRCVMCKQKDNGKNCWNLNSECGVSKGACTAYQGKLLPWEYQWNVISHK
YDTLYEKALIAADKGGLDTSSGDIDPKDKTLVEFLFNLYVQNCGKIGTIGTTGDKDTRDT
TPTVYSTAAGYIHEEAHIGDCKKQKQFCEKKNGAKPPSGDLEVDNGLCPLGINPYDHDMS
CDCGCRKKLQTKKSEGIVLVDPCNVVNTLLKDKNENSDIDQCIRKYKDGKEKYPGWDCTR
NKIKIGEEGAYMPPRRQKLCVDFLKQLKGQTDEKLVDAFIKSAAAETFLSWHKYKEDTQK
EKATHTADNDLNKGIIPEDFIRQMYYTFGDYRDLCMNKNIGNDVSNVESKIEGVFSKADG
TSSSNLSREVWWKKHGPKIWEGMLCALPGTENFKNKADYKNPPEDFAKQPQFLRW
Download sequence
Identical sequences Q8I957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]