SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8IAD6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8IAD6
Domain Number 1 Region: 409-726
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.7e-48
Family Duffy binding domain 0.0000259
Further Details:      
 
Domain Number 2 Region: 126-400
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.31e-47
Family Duffy binding domain 0.000037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8IAD6
Sequence length 1566
Comment (tr|Q8IAD6|Q8IAD6_PLAFA) JESEBL {ECO:0000313|EMBL:BAC44837.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=jesebl OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MKGKMNMCLFFFYSILYVVLCTYVLGISEEYLKERPQGLNVETNNNNNNNNNNSNSNDAM
SFVNEVIRFIENEKDDKEDKKVKIISRPVENTLHRYPVSSFLNIKKYGRKGEYLNRNSFV
QRSYIRGCKGKRSTHTWICENKGNNNICIPDRRVQLCITALQDLKNSGSETTDRKLLRDK
VFDSAMYETDLLWNKYGFRGFDDFCDDVKNSYLDYKDVIFGTDLDKNNISKLVEESLKRF
FKKDSSVLNPTAWWRRYGTRLWKTMIQPYAHLGCRKPDENEPQINRWILEWGKYNCRLMK
EKEKLLTGECSVNRKKSDCSTGCNNECYTYRSLINRQRYEVSILGKKYIKVVRYTIFRRK
IVQPDNALDFLKLNCSECKDIDFKPFFEFEYGKYEEKCMCQSYIDLKIQFKNIDICSFNA
QTDTVSSDKRFCLEKKEFKPWQCDKNSFETVHHKGVCVSPRRQGFCLGNLNYLLNDDIYN
VHNSQLLIEIIMASKQEGKLLWKKHGTILDNQNACKYINDSYVDYKDIVIGNDLWNDNNS
IKVQNNLNLIFERNFGYKVGRNKLFKTIKELKNVWWILNRNKVWESMRCGIDEVDQRRKT
CERIDELENMPQFFRWFSQWAHFFCKEKEYWELKLNDKCTGNNGKSLCQDKTCQNVCTNM
NYWTYTRKLAYEIQSVKYDKDRKLFSLAKDKNVTTFLKENAKNCSNIDFTKIFDQLDKLF
KERCSCMDTQVLEVKNKEMLSIDSNSEDATDISEKNGEEELYVNHNSVSVASGNKEIEKS
KDEKQPEKEAKQTNGTLTVRTDKDSDRNKGKDTATDTKNSPENLKVQEHGTNGETIKEEP
PKLPESSETLQSQEQLEAEAQKQKQEEEPKKKQEEEPKKKQEEEQKREQEQKQEQEEEEQ
KQEEEQQIQDQSQSGLDQSSKVGVASEQNEISSGQEQNVKSSSPEVVPQETTSENGSSQD
TKISSTEPNENSVVDRATDSMNLDPEKVHNENMSDPNTNTEPDASLKDDKKEVDDAKKEL
QSTVSRIESNEQDVQSTPPEDTPTVEGKVGDKAEMLTSPHATDNSESESGLNPTDDIKTT
DGVVKEQEILGGGESATETSKSNLEKPKDVEPSHEISEPVLSGTTGKEESELLKSKSIET
KGETDPRSNDQEDATDDVVENSRDDNNSLSNSVDNQSNVLNREDPIASETEVVSEPEDSS
RIITTEVPSTTVKPPDEKRSEEVGEKEAKEIKVEPVVPRAIGEPMENSVSVQSPPNVEDV
EKETLISENNGLHNDTHRGNISEKDLIDIHLLRNEAGSTILDDSRRNGEMTEGSESDVGE
LQEHNFSTQQKDEKDFDQIASDREKEEIQKLLNIGHEEDEDVLKMDRTEDSMSDGVNSHL
YYNNLSSEEKMEQYNNRDASKDREEILNRSNTNTCSNEHSLKYCQYMERNKNLLETCSED
KRLHLCCEISDYCLKFFNPKSIEYFDCTQKEFDDPTYNCFRKQRFTSMHYIAGGGIIALL
LFILGSASYRKNLDDEEGFYDSNLNDSAFEYNNNKYNKLPYMFDQQINVVNSDLYSEGIY
DDTTTF
Download sequence
Identical sequences A0A0L7M1W2 Q8IAD6
PFDG_02765T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]