SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8IGA7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8IGA7
Domain Number 1 Region: 26-346
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 8.24e-85
Family NAD kinase-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8IGA7
Sequence length 375
Comment (tr|Q8IGA7|Q8IGA7_DROME) SD09038p {ECO:0000313|EMBL:AAN71646.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG33156 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MKNSAMVMQIQDPASQRLTWYKPPLTVLVIKKVSDASVLAPFVYLVDWLLQEKNMVVWVE
SAVLEDVQLNENVRFKAIRDKLVTFKDGRDDLTDRIDFIVCLGGDGTLLYASLLFQQSVP
PVMAFHLGSLGFLTPFRFDNFEEQLTSVLEGHAALTLRSRLRCVMHRRSDRKHEAKTLEA
DLDGEARPAANSILVLNEVVIDRGPSPYLSNIDLFLDGKYITSVQGDGLIVSTPTGSTAY
AAAAGASMIHPSVPAIMVTPICPHSLSFRPIVVPAGVELKISVSPESRNTSWVSFDGRNR
QELFHGDSLRVTTSIYPVPCICAQDQISDWFASLADGLHWNVRKRQKCLDELSDLTASGS
EDTLDEIENMKLYDV
Download sequence
Identical sequences Q8IGA7
FBpp0086801 NP_788348.1.81976 FBpp0086801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]