SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8IK37 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8IK37
Domain Number 1 Region: 55-263,299-491
Classification Level Classification E-value
Superfamily Duffy binding domain-like 7.46e-79
Family Duffy binding domain 0.00033
Further Details:      
 
Domain Number 2 Region: 865-916,945-1015,1078-1132,1164-1193,1255-1422
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.58e-70
Family Duffy binding domain 0.0019
Further Details:      
 
Domain Number 3 Region: 484-710
Classification Level Classification E-value
Superfamily Duffy binding domain-like 7.32e-32
Family Duffy binding domain 0.0049
Further Details:      
 
Domain Number 4 Region: 1442-1457,1487-1626,1657-1677
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.67e-31
Family Duffy binding domain 0.0076
Further Details:      
 
Domain Number 5 Region: 1902-1937
Classification Level Classification E-value
Superfamily Adhesin YadA, collagen-binding domain 0.00000379
Family Adhesin YadA, collagen-binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8IK37
Sequence length 2241
Comment (tr|Q8IK37|Q8IK37_PLAF7) Erythrocyte membrane protein 1, PfEMP1 {ECO:0000313|EMBL:CZT98248.1} KW=Complete proteome; Reference proteome OX=36329 OS=Plasmodium falciparum (isolate 3D7). GN=PF10_0001 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MAAQSSGGGGGCGEEDKDAKYMFDRIGKEVHDEVKNAANVFKDYLKGNLTISTIFGEETV
AFTDPCELIKEKRDELLAARGDPCGKGKEHRFSKERGAECDDNKIEGNVRSKGKGGKSAG
ACAPYRRLSLCNKNFPNMNSKDSLKAKNDLLVDVCYAAKYEAESLIPYHDQYKLTYGDSQ
ICTVLARSFADIGDIVRGKDLFLGHNQRKKKLEERLEQMFKNITHSNAAKLSVLSSKEIR
EYWWALNRDQVWKALTCDEENKLGGNAYFHATCSERNGGCSQAHEKCRCPMTSDGKPNDQ
VPTYFDYVPQYLRWFEEWAEDFCRKKKIYVDIVKKYCRGERDGEKYCSLNGCDCTKTVRA
RGKLRYGNRCTDCLFACHRYENWIDNQRKQFLKQRNKYTEEINGTSTSSRTRRSARGGSD
HKGYEKIFYEKLEGEYRTVDGFLELLNKEKACQEVKDSEGGKINFSEKHSGNSNDETKGT
FYRSEYCQPCPYCGVRKTKGNQWENKSKNDQCNIKLYRPNPGESGTPIEILKSGEGETEI
ENKLNAFCAQTKNGSVVGGGSGGGNSDSKELYDEWQCYEFKQLTTDGQEDDDDEDYDKDV
RTGGGLCILEKKKEEGEAKSQNEPDEIQKTYNDFFYYWVAHMLKDSIHWRTKKLDKCINN
TNKSKACKNSNKCNNDCGCFQKWVDQKKEKEWDAIKQQFRKQKDIGDETNCDPIVTLEGV
LQIEFLKGDSEDSSEEKSENSLDAKEIQHLRQMLKQAGVAIGLDAFVALRGRCTEGGADS
QNKTTIDKLLDEEAKEAKDCQSKHKDPCPKPQDGVAGRSAEHPEEQEEEEEDDDEEIEEK
SEENDEESEKTVEDKETEAENVAEVPPTTQDNAEKPCDIVAELFKKPDTLKQACPTKYGS
KAPTSWKCIPTKPNSDSSTTGGGSDTGVPTTKSGATGKSGGSDTGSVCIPPRRRKLYVGE
LTKWAESKQVAQAQTTDTQTQVDAASTSTSQTSLLRDAFIQSAAVETFFLWHRYKKEWEL
RQKEAEQGQSGLPGIGVPGAGIPVVPGAGIPGVVGANGLSQPVLGVDNDNPQTSLQNGTI
PTDFLRQMFYTLGDYRDILFSGSNDTTSGSKDTSSGSNDNLKHIVLNAGGDQKSKDEMQT
IQTAISSYFSNSGKPSTSVTPVTQPSGTTPQALWSKYAESIWNGMVCALTYRDSGDKGGK
PQKVEAANGKLFQQLKDKYGEYDKVKLEEEDSENQAKGSSSQHPENPSTTSENKPTHLTD
FISRPPYFRYLEEWGQNFCKKRTEMLGKIKDNCTEDGGKTKKCSGDGHDCTDGKRRYNNM
FDDLDCRPCYEQCRKYRKWIDIKFVEYQNQKNKYGEEHEKLKTNSNGDNNCCTEIKEKTS
AADFLKALKHCKDGQTGGEKNKTHFENPETTFGPLDYCKTCPPNKVSCNVIRGRSGGRNG
CNVKDNEDKWKEVFDGISGNGGKSSTIEVEMIDRRGPYMKEYMKENSKNPFKTSRLFKGI
RKEQWECKVTNDDMHICKLDQFKENINLNPYTTFKVLLHYWLEDFLYGYYISKKKIEKCT
QKEKNACDEETKKNCVCVKTWVEQKKKEWKEIKKHFKNREQKYGQGNDIKSKVKMFLETL
IPLMDLVNNKGKHESLDAFLKSYECKCAESSGKKGGKENNIVLCLLDMLEKKATPCLSST
SDSSETPCENTPTTLDDDDPLEEENPVIHPQICGDIPTTKETVDEDACKRAEEPPKEPAP
TGPKKPAPTAGGEEDQTEKDTEVNPLAPAPADETFDPTILQTTIPLGIALALGSIAFLFL
KKKTKASVGNLFQILQIPKSDYDIPTKLSPNRYIPYTSGKYRGKRYIYLEGDSGTDSGYT
DHYSDITSSSESEYEEFDINDIYVPGSPKYKTLIEVVLEPSGNNTTASGNNTTASGNNTT
ASGNNTTASGNNTTASDTQNDIQNDGIPSSKITDNEWNTLKDEFISQYLQSEQPKDVPND
YKSGNSSTNTNITTTSRDNMEEKPFIMSIHDRDLYSGEEYSYNVNMSTNSMDDPKYVSNN
VYSGIDLINDSLNSNNVDIYDEVLKRKENELFGTNHVKQTSIHSVAKLTNSDPIHNQLEL
FHTWLDRHRDMCEKWNNKEEVLDKLKEEWENDTSTSGNTHPSDSNKTLNTDVSIQIHMDN
PKPINQFNNMDTILEDLDKPFNEPYYYDMYDDDIYYDVNDDNDTSTVDSNNMDVPSKVQI
EMDVNTKLVKEKYPISDVWDI
Download sequence
Identical sequences A0A2I0BR82 Q8IK37
5833.PF10_0001-1 XP_001347288.1.26446 gi|124801837|ref|XP_001347288.1| gi|23494866|gb|AAN35201.1| PF10_0001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]