SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8IMI2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8IMI2
Domain Number 1 Region: 172-259
Classification Level Classification E-value
Superfamily TPR-like 0.0000531
Family Tetratricopeptide repeat (TPR) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8IMI2
Sequence length 536
Comment (tr|Q8IMI2|Q8IMI2_DROME) Uncharacterized protein, isoform A {ECO:0000313|EMBL:AAN14239.2} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG31524 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MPVLKLLFVVIFFLSLSMGQIEATQPRFARSVVNMDDLLNMEDDLVSKLEGYAEKLSYKA
NTIRWGIQQMREQLDKSKKEQSFDLFNRYSFIRHMQADWLMWKQYLDKPVIRDELNYKQM
DNLRMPQELDLFDASEAIRRMQATYAMLSNDIAEGFLDGVQYTSKLSPIDCLAMGRHLMN
QSRWTIAEQWILAGIKAQDRKGPQTEMILLRGPTKAELFRTLGKVRFERRNEEGALKAYQ
AALKHSPHDLEIFQEYQNLKRRVLTLSPSEPIREEPNDDIEEMELPPCCSGRCEGPRKLN
RLYCVYNCVTAPFLRLAPIKTEILSVDPFVILLHDMVSHKEGALIRSSSKNQILPSETVN
AANEFEIAKFRTSKSVWFDSDANEATLKLTQRLGEATGLDMKHSEPFQVINYGIGGVFES
HFDTSLADEDRFVNGYIDRLATTLFYLNDVPQGGATHFPGLNITVFPKFGTVLMWYNLHT
EGMLHVRTMHTGCPVIVGSKWVVSKWIDDKGQEFRRPCLRSRLDSKYLSSIEKIII
Download sequence
Identical sequences Q8IMI2
NP_733379.2.81976 7227.FBpp0085046 FBpp0085046 FBpp0110159 FBpp0085046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]