SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8IMX1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8IMX1
Domain Number 1 Region: 207-550
Classification Level Classification E-value
Superfamily DNase I-like 5.5e-38
Family DNase I-like 0.078
Further Details:      
 
Domain Number 2 Region: 64-178
Classification Level Classification E-value
Superfamily L domain-like 5.1e-19
Family Ngr ectodomain-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8IMX1
Sequence length 567
Comment (tr|Q8IMX1|Q8IMX1_DROME) Twin, isoform C {ECO:0000313|EMBL:AAN13986.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG31137 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MCIFKKRDAYHQAVIMKGNHYKMSRNKDKYDSANRRQQIFLSQEDIAAGKKTNWSGLEIT
GCVRNISPSLWEFEHLTALYLNDNQLLRLPADVGMLTSLRTLDLSSNKLRSLPAELGELI
QLRELLLNNNFLRVLPYEIGKLFHLVILGLMGNPLQKEFMNIYNEPNGTQKLLTYMLDNL
SFTVNPPPQRPWLPLAKPNKTRPACIFTVMCYNVLCDKYATRQMYGYCPSWALCWEYRKK
SIIDEIRHYAADIISLQEIETEQFYHFFLPELKNDGYEGIFSPKSRAKTMSELERKYVDG
CAIFFRASKFTLIKESLIEFNQLAMANAEGSDNMLNRVMPKDNIGLAALLKVKENAWEPM
SEVTQISQPLLVCTAHIHWDPEFCDVKLIQTMMLSNELKTIIDEASHSFRPGHKNDSNAV
QLLLCGDFNSLPDSGVVEFLGKGRVSMDHLDFKDMGYKSCLQRLLSNDTNEFTHSFKLAS
AYNEDIMPHTNYTFDFKGIIDYIFYTKTGMVPLGLLGPVSNDWLRENKVVGCPHPHIPSD
HFPLLVELELMHTASQQAPPNGLINRR
Download sequence
Identical sequences Q8IMX1
7227.FBpp0083954 NP_732964.1.81976 FBpp0083954 FBpp0083954 FBpp0083953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]