SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8IP18 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8IP18
Domain Number 1 Region: 352-455
Classification Level Classification E-value
Superfamily Chaperone J-domain 3.4e-29
Family Chaperone J-domain 0.00023
Further Details:      
 
Domain Number 2 Region: 5-100
Classification Level Classification E-value
Superfamily TPR-like 2.2e-26
Family Tetratricopeptide repeat (TPR) 0.00066
Further Details:      
 
Domain Number 3 Region: 236-354
Classification Level Classification E-value
Superfamily TPR-like 1.14e-24
Family Tetratricopeptide repeat (TPR) 0.0014
Further Details:      
 
Domain Number 4 Region: 130-233
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000104
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8IP18
Sequence length 464
Comment (tr|Q8IP18|Q8IP18_DROME) Tetratricopeptide repeat protein 2, isoform E {ECO:0000313|EMBL:AGB93037.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG4599 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MLYIAEEKKKLGNDQYKAQNYQNALKLYTDAISLCPDSAAYYGNRAACYMMLLNYNSALT
DARHAIRIDPGFEKAYVRVAKCCLALGDIIGTEQAVKMVNELNSLSTAVAAEQTAAQKLR
QLEATIQANYDTKSYRNVVFYLDSALKLAPACLKYRLLKAECLAFLGRCDEALDIAVSVM
KLDTTSADAIYVRGLCLYYTDNLDKGILHFERALTLDPDHYKSKQMRSKCKQLKEMKENG
NMLFKSGRYREAHVIYTDALKIDEHNKDINSKLLYNRALVNTRIGNLREAVADCNRVLEL
NSQYLKALLLRARCYNDLEKFEESVADYETALQLEKTPEIKRMLREAKFALKKSKRKDYY
KILGIGRNASDDEIKKAYRKKALVHHPDRHANSSAEERKEEELKFKEVGEAYAILSDAHK
KSRYDSGQDIEEQEQADFDPNQMFRTFFQFNGGGRNNSSFNFEF
Download sequence
Identical sequences Q8IP18
NP_001260502.1.81976 NP_723974.1.81976 FBpp0080424 FBpp0080424 FBpp0305672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]