SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8IPJ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8IPJ9
Domain Number 1 Region: 7-69
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000341
Family ZZ domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8IPJ9
Sequence length 557
Comment (tr|Q8IPJ9|Q8IPJ9_DROME) Uncharacterized protein {ECO:0000313|EMBL:AAN10582.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG31642 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MAHQMRNPPERHFGHRCENCKISDFQGRRYTCRFCAEYTLCGKCFDANHLPASPQHRYYH
PMSVYYAYAEYQLYFGGEPFCGDHKVAQSYKCALCDVRGLSTAHLFMHLLQEHRDHRDHD
AYLSLVNTLYIADNGMEQQVPVPQPSSQTRSTRSRNLASVRPVAGGNTRSEQRTEQVFDS
ALSLALMVVQLDNMDSTAADFPERCYEILQQTETVLMQHRSSRVPDMEAIESFVRVIEDQ
VVTSMADRRQRLGASSSSLHRLTRIEAISPGTNTALAMGMRAAMPVLVDQPTTMVRRQTA
RRTGEPIGIALQSAVASSSRSGKAGSSSGVAKAQTKTQGDQPTKKVSTVITSPLKDKRFL
CSKLVSGNGQKWESKLLKATFTEAMFCSMLADEELFQPPIGLPWTANFMLDAVEPSGSVK
SNGKLLLYPVKTKELMERFYRGLAEYKTWIGYQTEPTAESKATELPSASTSSAYFTVLGD
IPYADSGSDDLESNASEEMASDLHGEGNSDDLAGLEEDKESGEEENGDEDDGASDSDFSE
SAISQITDFIDMVIQDE
Download sequence
Identical sequences Q8IPJ9
NP_723159.1.81976 FBpp0078830 7227.FBpp0078830 FBpp0078830 FBpp0078830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]