SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8IQS7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8IQS7
Domain Number 1 Region: 53-259,300-486
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000129
Family Tetratricopeptide repeat (TPR) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8IQS7
Sequence length 520
Comment (tr|Q8IQS7|Q8IQS7_DROME) Uncharacterized protein {ECO:0000313|EMBL:AAN11679.2} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG32201 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MRKYHSLLPVLLGFAVLNSFVGCVEDIEEKERYSSSTVGLLKLLKVEEKFTDNLLNQVDQ
LGEKFEALRMYLSSVGYELHRSLNEKVQYVSNPINAFSLLRRTHEDLPKWHEYFKEAIGE
GNQSILVDLVKMVPNDVDMLSAMHGIQRIEKIYDLKIDDLAQGVLQGVQYNVQLTYRDLI
AMGNSMYQQSDYQTAAKWYRIACKRELENPEQLFIQILGDPSEHLHRQYIKSLFKYGSTT
SEPSKSIEEAFIMVQASQEELDNIMSDLNEPQNDVEVEKDLYQVKRSPSNCELGCRGLYR
QKTNLVCRYKSTANTFLRLAPLKLEEISLDPFMAMYHEVLYDSEIRELKGQSMNMVNGYA
SQRNGTEIRDTVVRYDWWSNTSLVRERINQRIIDMTGFNFLKDEKLQIANYGLGTYFQPH
FDYSSDGFETPNITTLGDRLASILFYASEVPQGGATVFPEINVTVFPQKGSMLYWFNLHD
DGKPDIRSLHSVCPVLNGDRWTLTKWVPMFPQMFSFPCKS
Download sequence
Identical sequences Q8IQS7
NP_730346.2.81976 FBpp0289328 FBpp0289328 FBpp0289328 7227.FBpp0289328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]