SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8K2B3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8K2B3
Domain Number 1 Region: 52-313,412-481
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.85e-80
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.00000036
Further Details:      
 
Domain Number 2 Region: 290-408
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 2.39e-42
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.00000604
Further Details:      
 
Domain Number 3 Region: 503-664
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 1.2e-41
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8K2B3
Sequence length 664
Comment (sp|Q8K2B3|SDHA_MOUSE) Flavoprotein subunit of complex II KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Sdha; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MAGVGAVSRLLRGRRLALTGAWPGTLQKQTCGFHFSVGENKKASAKVSDAISTQYPVVDH
EFDAVVVGAGGAGLRAAFGLSEAGFNTACLTKLFPTRSHTVAAQGGINAALGNMEEDNWR
WHFYDTVKGSDWLGDQDAIHYMTEQAPASVVELENYGMPFSRTEDGKIYQRAFGGQSLKF
GKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIE
DGSIHRIRAKNTVIATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTGI
YGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPE
KDHVYLQLHHLPPEQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQ
VLKHVNGQDQIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAESCRPGDK
VPSIKANAGEESVMNLDKLRFADGSIRTSELRLNMQKSMQNHAAVFRVGSVLQEGCEKIS
QLYGDLKHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKVR
VDEYDYSKPIQGQQKKPFGEHWRKHTLSYVDIKTGKVTLEYRPVIDKTLNEADCATVPPA
IRSY
Download sequence
Identical sequences Q8K2B3
NP_075770.1.92730 ENSMUSP00000022062 ENSMUSP00000022062 10090.ENSMUSP00000022062 ENSMUSP00000022062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]