SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8K2I3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8K2I3
Domain Number 1 Region: 3-231
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.3e-51
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0026
Further Details:      
 
Domain Number 2 Region: 297-486
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000000022
Family FAD/NAD-linked reductases, N-terminal and central domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8K2I3
Sequence length 535
Comment (sp|Q8K2I3|FMO2_MOUSE) Pulmonary flavin-containing monooxygenase 2 KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Fmo2; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MAKKVVVIGAGVSGLISLKCCVDEGLEPTCFERTEDIGGLWRFKENVEDGRASIYRSVIT
NTSKEMSCFSDFPMPEDFPNFLHNSKLLEYFRIFAKKFDLLKYIQFQTTVISVKKRPDFA
SSGQWEVYTQSNGKEQRTVFDAVMVCSGHHIQPHLPLKSFPGIERFRGQYFHSREYKHPV
GFEGKRILVVGIGNSAADIASELSKTAAQVFVSTRHGSWVMSRISEDGYPWDMVFHTRFS
SMLRNVLPRTVVKWMMEQQMNRWFNHENYGLVPQNKYLMKEPVLNDDLPSRLLYGAIKVK
TRVKELTETAVVFEDGTVEEDVDIIVFATGYTFSFSFLEDSLVKVEDNRVSLYKAMFPPH
LEKPTLACIGLIQPLGSIFPTVELQARWATRVFKGLCSLPSETTMMADIVERNEKRVNLF
GKSQSQILQTNYVDYLDELALEIGAKPDFVSLFFKDPKLAVKLYFGPCNSYQYRLVGPGQ
WEGARNAILTQKQRILKPLKTRTLQSSDSAPVSFLLKILGLLAVVLAFFFQLQGF
Download sequence
Identical sequences Q8K2I3
ENSMUSP00000044405 NP_061369.2.92730 XP_006497012.1.92730 10090.ENSMUSP00000107135 ENSMUSP00000044405 ENSMUSP00000044405 ENSMUSP00000107135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]