SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8K342 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8K342
Domain Number 1 Region: 28-120
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.91e-22
Family Ras-binding domain, RBD 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8K342
Sequence length 435
Comment (sp|Q8K342|RASF9_MOUSE) Peptidylglycine alpha-amidating monooxygenase COOH-terminal interactor KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Rassf9; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MAPFGRNLLKTRHKNRSPTKDMDPEEKEIVVWVCQDEKIVCGLTKRTTSIDVIQALLEEH
EATFGEKRFLLGKASDYCIVEKWRGSERALPPLTRILKLWKAWGDEQPNMQFVLVKTDAF
LPVPLWRTAETKLVQNNEKPWELSPANYMKTLPPDKQKRIVRKTFRKLAKIRQDTSSHDR
DNMECLVHLIISQDHTIHQQVQRMKELDMEIEKCEAKIHLDRVGNDGANYVHEAYLMPRL
SDEEQKLDIQAEINQTLEDLNDSEGMAQLEEQLQYYRALIDKLSAEIEREVKGAGIDGIE
DMEGAAACELENSDLESVKCDLETSMKAGLTIHSHLSGIQREIKYSDSLLQMKAREYELL
AKEFSSLHISNKDGCQGKENRGKEAEAPSSNGETPPLTQRVFNIYTNDTDSDTGISSNHS
QDSETTLGDVLLLAT
Download sequence
Identical sequences Q8K342
ENSMUSP00000054767 ENSMUSP00000054767 ENSMUSP00000054767 10090.ENSMUSP00000054767 NP_666352.1.92730 GO.34620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]