SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8K3E8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8K3E8
Domain Number 1 Region: 59-252
Classification Level Classification E-value
Superfamily Sec7 domain 2.49e-81
Family Sec7 domain 0.00000000501
Further Details:      
 
Domain Number 2 Region: 260-380
Classification Level Classification E-value
Superfamily PH domain-like 1.29e-35
Family Pleckstrin-homology domain (PH domain) 0.00000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8K3E8
Sequence length 397
Comment (tr|Q8K3E8|Q8K3E8_MOUSE) Pleckstrin homology, Sec7 and coiled-coil domains 1, isoform CRA_c {ECO:0000313|EMBL:EDL34653.1} OX=10090 OS=Mus musculus (Mouse). GN=mCG_142715 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MEDDDSYVPSDLTAEERQELENIRRRKQELLADIQRLKEEIAEVANEIESLGSTEERKNM
QRNKQVAMGRKKFNMDPKKGIQFLIENGLLKNTCEDIAQFLYKGEGLNKTAIGDYLGERD
EFSIQVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNTGVF
QSTDTCYVLSFAIIMLNTSLHNPNVKDKPTVERFIAMNRGINDGGDLPEELLRNLYESIK
NEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEP
RGIIPLENLSIREVEDSKKPNCFELYIPDNKDQVIKACKTEADGRVVEGNHTVYRISAPT
PEEKEDWIKCIKAAISRDPFYEMLAARKKKVSSTKRH
Download sequence
Identical sequences B2GUV0 Q8K3E8
ENSMUSP00000017276 ENSRNOP00000004196 NP_001106169.1.92730 XP_006247846.1.100692 XP_021067356.1.100879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]