SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8K3U5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8K3U5
Domain Number 1 Region: 41-164
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 6.95e-33
Family Myeloperoxidase-like 0.000000338
Further Details:      
 
Domain Number 2 Region: 1-38
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000192
Family EGF-type module 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8K3U5
Sequence length 164
Comment (tr|Q8K3U5|Q8K3U5_CAVPO) Cyclooxygenase-2 {ECO:0000313|EMBL:AAM96697.1} OX=10141 OS=Cavia porcellus (Guinea pig). GN= OC=Hystricomorpha; Caviidae; Cavia.
Sequence
NPCCSNPCQNRGECLSVGFDRYKCDCTRTGYYGENCTTPEFLTRIKLLLKPTPNTVHYIL
THFKGVWNIVNNIPFLRNAIMKYVLTSRSHLIDSPPTYNAHYGYKSWEAFSNLSYYTRAL
PPVADDCPTPMGVKGKKELPDSNEVLEKVLLRRKFIPDPQGTNM
Download sequence
Identical sequences Q8K3U5
ENSCPOP00000015084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]